PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_5673_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 1011aa    MW: 109466 Da    PI: 4.7998
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_5673_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.66.9e-0962103346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT+eE e++ d  + +G++ +++Ia+ +   +t  +c+++++k
    Neem_5673_f_4  62 PWTPEEREIFMDKLATFGKD-FRKIASFLD-YKTTADCVEFYYK 103
                      8*****************99.*********.9**********98 PP

2Myb_DNA-binding35.32.7e-11277318346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT eE  ++++av  +G++ ++ Iar++  +R++ qck ++ k
    Neem_5673_f_4 277 DWTDEEKSIFIQAVSSYGKD-FSMIARCVR-TRSRDQCKVFFSK 318
                      6*****************99.*********.********88765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.47E-1446107IPR009057Homeodomain-like
PROSITE profilePS5129314.94758109IPR017884SANT domain
SMARTSM007171.3E-859107IPR001005SANT/Myb domain
PfamPF002491.2E-661103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-662107IPR009057Homeodomain-like
PROSITE profilePS5129312.057273324IPR017884SANT domain
SMARTSM007173.7E-9274322IPR001005SANT/Myb domain
SuperFamilySSF466892.34E-11275324IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-7277318IPR009057Homeodomain-like
PfamPF002491.2E-8277317IPR001005SANT/Myb domain
CDDcd001673.32E-8278316No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1011 aa     Download sequence    Send to blast
MEIVNFTSKL LCDSQVKVYR DFLKMPALML DNREKMASRF ISNNGLVEDP CAVEKERAMI  60
NPWTPEEREI FMDKLATFGK DFRKIASFLD YKTTADCVEF YYKNHKSDSF EKLKKQHDFS  120
KQGKASTNTY LVTSGKRNRK MNAASLDILG EASEMAAAAQ VDNCRLISSG RISLGGGVSK  180
ISLGDDGIIE RSSSFDVVGS ERETAAADVL AGICGSLSSE AMSSCITSSV DPGEGQREWR  240
HQKVDSVMRR PSTSDVTQNV DDDSCSDESG GEMDPSDWTD EEKSIFIQAV SSYGKDFSMI  300
ARCVRTRSRD QCKVFFSKAR KCLGLDLIHT GQGNVGTSVN DDGNGGGSDT EDACVLETSS  360
AICSDKLDSK MDEDLRTHLM NINQDESVPA GAMSLQNDLN KSEDDNGAEV LGAGAMSLQN  420
DLNKSEDDNG AEVLDDKDSE DVKHLIYDAC KMEDMHYELE CHSKNGVCNQ SESVLAKKNA  480
AGLAATDGGV SASAGEPVDP CPSSSNALEE TIEVLAEAST KGFGHGLEGH NGLNDEQDKN  540
GNVDTSGESE MVLDSDAPGN ALDLAVDASS CSVPLKLDAV DNPPVISLPQ ENSHAVATFM  600
HQDSSVRQYE KMLNQDRMSS TLDLQGNKDK NAHKSVSSND YHQDVTGHSL LNHDESSQIL  660
KGYPLAVPTN KEMSGDINCR QLSEVQSVLT SDRNTDGPYL SQDCYLRKCN SSTSYSSIAE  720
LPLLSQNVEE TSDHPKTHSH SLSDPEKPCK NGDVKLFGKI LSHPSSSQKS NFGSHENEEK  780
GAHNHKQSSK ASNVKFTAQH PTDGSAAVLK FDRNNYVGLE NVPVRSYGFW DGNRIQTGFS  840
SLPDSAILLA KYPAAFSNYP ASSSKMEQQS LQAVVKSNER NLNGVAVLPS REINSSSGVV  900
DYQVYRSREG TKVQPFTVDM KQRQELIFSE MQRRNGFETL PSLQQQGKGM VGVNVVARGG  960
ILVGGGGGGG SCTGVSDPVA AIRMHYAKNG GQGGSIIGEE ESWRGKGDIG R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C5e-15291111294NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D5e-15291111294NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006485885.10.0PREDICTED: uncharacterized protein LOC102608361 isoform X3
TrEMBLV4VB500.0V4VB50_9R
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-114MYB family protein